PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_12041_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 492aa    MW: 55079.6 Da    PI: 7.9372
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_12041_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.22.5e-202773148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                          +g+WT+eEde++v++v+++G+  W+ Ia+ ++ gR +kqc++rw+++l
  cra_locus_12041_iso_3_len_1939_ver_3 27 KGPWTQEEDEKIVQLVAKYGPTKWSVIAKSLP-GRIGKQCRERWHNHL 73
                                          79******************************.*************97 PP

2Myb_DNA-binding53.94.1e-1779122146
                                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                           +++WT eE++ l +a++ +G++ W+ Ia+ ++ gRt++ +k++w++
  cra_locus_12041_iso_3_len_1939_ver_3  79 KDAWTLEEELALMNAHRVHGNK-WAEIAKVLP-GRTDNAIKNHWNS 122
                                           679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-10134IPR009057Homeodomain-like
PROSITE profilePS512947.938121IPR017930Myb domain
PROSITE profilePS5129432.7412277IPR017930Myb domain
SuperFamilySSF466894.49E-3224120IPR009057Homeodomain-like
SMARTSM007178.5E-192675IPR001005SANT/Myb domain
PfamPF002493.3E-192773IPR001005SANT/Myb domain
CDDcd001677.15E-172973No hitNo description
Gene3DG3DSA:1.10.10.601.2E-273580IPR009057Homeodomain-like
SMARTSM007177.0E-1678126IPR001005SANT/Myb domain
PROSITE profilePS5129422.50378128IPR017930Myb domain
PfamPF002492.9E-1579122IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-2381128IPR009057Homeodomain-like
CDDcd001672.88E-1281124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
IAEFFPDRSE VQCLHRWQKV LNPELVKGPW TQEEDEKIVQ LVAKYGPTKW SVIAKSLPGR  60
IGKQCRERWH NHLNPNIKKD AWTLEEELAL MNAHRVHGNK WAEIAKVLPG RTDNAIKNHW  120
NSSLKKKLDF YLATGNLPPV AKNGLQNGSK DLSTTASTGN LIDSFTRGSD LTATSPGIGD  180
GCKLEVVGKD NTEIAILSQC VGVSTSCPQQ ESADYEDIRY EELSSQVNSI EIDPESAVKL  240
DQCRTHSENV KYEVPQGSLH SPVPEYGPLY YEPPQLESFV PLYPDVQSIC WVQYDSNSSL  300
TLSPVAFFTP PRVRADELFT QTPESILKIA AKSFPHTPSI LRKRKTETQS STSSNKVEKV  360
GNRSSSFQRS CHESPCDDKL NDSKTFNASP PYRLRSKRTT IFKSVEKQLE FSFNREQSKN  420
ISKPGSSTIM DISPNKNNLX DIKDGRDIDC NGMKVGEFSK LATVFRVADK DKMQAAGLSK  480
AFHNSTAEHH GY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C7e-64112832159MYB PROTO-ONCOGENE PROTEIN
1h88_C7e-64112832159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00482DAPTransfer from AT5G02320Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002270472.11e-175PREDICTED: uncharacterized protein LOC100256181
RefseqXP_010654284.11e-175PREDICTED: uncharacterized protein LOC100256181
TrEMBLA0A068UEC50.0A0A068UEC5_COFCA; Uncharacterized protein
STRINGVIT_08s0007g00360.t011e-174(Vitis vinifera)